PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D01809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 235aa    MW: 25310.1 Da    PI: 5.8887
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D01809.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.56.1e-14846341
             TCR  3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                    + +CnCkk+ Clk+YC+Cf+ + +Cs+ C+C++C N+e+
  Pahal.D01809.1  8 RPSCNCKKTTCLKRYCQCFQGHFFCSHACNCKGCWNSEH 46
                    568*********************************986 PP

2TCR45.31.7e-1480117239
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     + kgC+C+ks C+k+YCeCf++++ C+ +CkC++C+N+
  Pahal.D01809.1  80 HGKGCTCNKSGCKKNYCECFKKQVACTTRCKCQGCENS 117
                     579**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.2E-9547IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163425.7357119IPR005172CRC domain
PfamPF036382.0E-101044IPR005172CRC domain
SMARTSM011149.8E-979120IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-1082117IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDEDKEQRPS CNCKKTTCLK RYCQCFQGHF FCSHACNCKG CWNSEHRRTF VEEHAELRLK  60
TKPGASQSKD SALAGEQRVH GKGCTCNKSG CKKNYCECFK KQVACTTRCK CQGCENSYGT  120
GGEGLQGNGD PGGPSGQPDG APDGSDGSPG GSGESAVVID EELLRPTEAG VAENVVAIDD  180
PLDPSTYSWN QAPVQATLTH ETLTTTTRMI PMQVGIDEAA EIQNIGNRYD CTWH*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969151.11e-101PREDICTED: protein tesmin/TSO1-like CXC 3
TrEMBLK3XLU81e-101K3XLU8_SETIT; Uncharacterized protein
STRINGSi002871m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122672336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.11e-21Tesmin/TSO1-like CXC domain-containing protein